DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and lin-32

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_508410.2 Gene:lin-32 / 191703 WormBaseID:WBGene00003018 Length:142 Species:Caenorhabditis elegans


Alignment Length:95 Identity:44/95 - (46%)
Similarity:57/95 - (60%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 SFDLADGENQDAAAGGSGKK-----RRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYL 282
            :|.|......|:.:.|.||.     ||.|..:|.:.|.||.|||.||||||..||.|:|.||:.|
 Worm    35 NFSLDSPNYPDSLSNGGGKDDKKKCRRYKTPSPQLLRMRRSAANERERRRMNTLNVAYDELREVL 99

  Fly   283 PCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            |.:.:.::|||.|||||||.||..|..:|:
 Worm   100 PEIDSGKKLSKFETLQMAQKYIECLSQILK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 33/58 (57%)
lin-32NP_508410.2 HLH 73..124 CDD:278439 31/50 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167233
Domainoid 1 1.000 68 1.000 Domainoid score I6373
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14717
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.