DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and hlh-10

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_505401.2 Gene:hlh-10 / 191402 WormBaseID:WBGene00001954 Length:202 Species:Caenorhabditis elegans


Alignment Length:246 Identity:62/246 - (25%)
Similarity:102/246 - (41%) Gaps:78/246 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SSSPASHRSESPEYVDLNTMYNGGCNNMAQNQQY-------GMIMEQSVVSTAPAIPVASPPAVE 131
            |||..:|:.|.   :||:| .|.|.:.::..||.       ||.::|::.:.          .::
 Worm     3 SSSMTTHQEEP---LDLST-GNHGNSELSDEQQIMQVMESCGMFLQQNLFAW----------FLQ 53

  Fly   132 VMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSA 196
            .|          :.|||           :||..|....|.                         
 Worm    54 SM----------LEASA-----------SQPQLTQDEPPE------------------------- 72

  Fly   197 LFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAAN 261
              :|:.|:  ||:..:..|..|.|:.:........:..:.|...::..||..|      ||..||
 Worm    73 --NDTKEN--DLVKQNKSEVNDENESTPSPTQNSRRRTSTGKIDRRMVGKMCT------RRYEAN 127

  Fly   262 ARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            ||||.|:|.|::.||:||..|| :.:|.::||..||::|.:||..||.:|:
 Worm   128 ARERNRVQQLSKMFDQLRVCLP-IEDDAKISKLATLKVASSYIGYLGAILQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 27/58 (47%)
hlh-10NP_505401.2 bHLH_SF 121..179 CDD:381792 29/64 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.