powered by:
Protein Alignment ato and hnd-1
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509952.1 |
Gene: | hnd-1 / 183457 |
WormBaseID: | WBGene00001981 |
Length: | 226 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 23/61 - (37%) |
Similarity: | 38/61 - (62%) |
Gaps: | 2/61 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 253 KRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKHETLQMAQTYISALGDLL 311
|:.|:..:..:|.||.|.:|.||:.|:|::|.|.:: :.|.|.:||::|..||..|..||
Worm 21 KKSRKEKSREKEHRRAQCINSAFEILQQHIPYLKSEERKSLPKIKTLRLAMQYIDHLKKLL 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000894 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.