powered by:
Protein Alignment ato and cnd-1
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379767.1 |
Gene: | cnd-1 / 183212 |
WormBaseID: | WBGene00000561 |
Length: | 192 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 32/63 - (50%) |
Similarity: | 43/63 - (68%) |
Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 251 VVKRK-RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
:.||| ||:.||.|||.||..||.|.|.||:|:|.....::|||.|||::|:.||.||..:|:
Worm 14 ISKRKVRRVKANGRERARMHGLNNALDMLREYIPITTQHQKLSKIETLRLARNYIDALQRMLQ 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2611 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.