DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and hlh-12

DIOPT Version :10

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_501445.1 Gene:hlh-12 / 182980 WormBaseID:WBGene00001956 Length:150 Species:Caenorhabditis elegans


Alignment Length:56 Identity:22/56 - (39%)
Similarity:31/56 - (55%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            ||..||.|||:|:..:|..||.|...||......:||:.:.|:.|.:||..|.:.|
 Worm    14 RRSRANERERQRVSEMNGMFDVLLNLLPPSHFKTRLSRVQILREATSYIIRLHNFL 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 21/54 (39%)
hlh-12NP_501445.1 HLH 14..66 CDD:459628 20/51 (39%)

Return to query results.
Submit another query.