DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurod2

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_035025.3 Gene:Neurod2 / 18013 MGIID:107755 Length:383 Species:Mus musculus


Alignment Length:201 Identity:59/201 - (29%)
Similarity:79/201 - (39%) Gaps:69/201 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEF 187
            |...|||               |.|..|.|.|:....:.........||.|              
Mouse    37 PPQPPPA---------------PGSGAPGPARAAKPVSLRGGEEIPEPTLA-------------- 72

  Fly   188 QNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVV 252
                         .|:::.:|    |||:.:..:      :.|..|.|.|...|||..|      
Mouse    73 -------------EVKEEGEL----GGEEEEEEE------EEEGLDEAEGERPKKRGPK------ 108

  Fly   253 KRK-----------RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISA 306
            |||           ||..||||||.||.:||.|.|.||:.:||....::|||.|||::|:.||.|
Mouse   109 KRKMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWA 173

  Fly   307 LGDLLR 312
            |.::||
Mouse   174 LSEILR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 32/69 (46%)
Neurod2NP_035025.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..130 32/150 (21%)
bHLH_TS_NeuroD2 89..181 CDD:381563 42/103 (41%)
Nuclear localization signal. /evidence=ECO:0000255 108..114 4/11 (36%)
Neuro_bHLH 181..311 CDD:372170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.