DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurod1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_035024.1 Gene:Neurod1 / 18012 MGIID:1339708 Length:357 Species:Mus musculus


Alignment Length:143 Identity:51/143 - (35%)
Similarity:79/143 - (55%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 YTEE-FQNFDFDNSALFDDSVEDDEDLM------LFSGGEDFDGNDGSFDLADGENQDAAAGGSG 240
            :|:| ..:.|.::.|   |..||:.:.|      |.:|||:.:.::   ||.:.|.::.......
Mouse    22 WTDECLSSQDEEHEA---DKKEDELEAMNAEEDSLRNGGEEEEEDE---DLEEEEEEEEEEEDQK 80

  Fly   241 KKRRGKQITPVVKRK------RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQM 299
            .||||.:...:.|.:      ||:.||||||.||..||.|.|.||:.:||....::|||.|||::
Mouse    81 PKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRL 145

  Fly   300 AQTYISALGDLLR 312
            |:.||.||.::||
Mouse   146 AKNYIWALSEILR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 30/64 (47%)
Neurod1NP_035024.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 19/77 (25%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 0/5 (0%)
HLH 100..158 CDD:238036 29/57 (51%)
Neuro_bHLH 160..284 CDD:289310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.