DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Myod1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_034996.2 Gene:Myod1 / 17927 MGIID:97275 Length:318 Species:Mus musculus


Alignment Length:140 Identity:45/140 - (32%)
Similarity:57/140 - (40%) Gaps:29/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 FDDSVEDDEDLMLFSGGEDFD------------GNDGSFDLA----DGENQDA-AAGGSGKKRRG 245
            :||...|..||..|   ||.|            .....|..|    .|..:|. ....||..:.|
Mouse    30 YDDPCFDSPDLRFF---EDLDPRLVHMGALLKPEEHAHFPTAVHPGPGAREDEHVRAPSGHHQAG 91

  Fly   246 KQI---TPVVKRK-----RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQT 302
            :.:   ....|||     ||.||..|||||:..:|:||:.|::......|.| |.|.|.|:.|..
Mouse    92 RCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQR-LPKVEILRNAIR 155

  Fly   303 YISALGDLLR 312
            ||..|..|||
Mouse   156 YIEGLQALLR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 27/63 (43%)
Myod1NP_034996.2 BASIC 19..114 CDD:128794 21/86 (24%)
HLH 110..161 CDD:278439 22/51 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..225
Myf5 190..258 CDD:289036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..318
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.