DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Myf5

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_032682.1 Gene:Myf5 / 17877 MGIID:97252 Length:255 Species:Mus musculus


Alignment Length:112 Identity:36/112 - (32%)
Similarity:56/112 - (50%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GEDFDGNDGSF-----DLADGENQDAAAGGSGKKRRGKQI---TPVVKRK-----RRLAANARER 265
            |:.|:....:|     :|...::::.....:|..:.|..:   ....|||     ||.||..|||
Mouse    29 GDQFEPRVAAFGAHKAELQGSDDEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRER 93

  Fly   266 RRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            ||::.:||||:.|::......|.| |.|.|.|:.|..||.:|.:|||
Mouse    94 RRLKKVNQAFETLKRCTTTNPNQR-LPKVEILRNAIRYIESLQELLR 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 28/63 (44%)
Myf5NP_032682.1 BASIC 1..88 CDD:128794 11/58 (19%)
bHLH_TS_Myf5 83..146 CDD:381507 27/58 (47%)
Myf5 143..214 CDD:371979
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.