DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Mycs

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_034980.2 Gene:Mycs / 17870 MGIID:1332242 Length:431 Species:Mus musculus


Alignment Length:227 Identity:46/227 - (20%)
Similarity:77/227 - (33%) Gaps:72/227 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 PAIPVASPPAVEV-----MGS------SNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPTAA 173
            |.||.::..|:.:     :.|      ||.|:.:    ..|.:......::.|.|.|.:..||||
Mouse   207 PTIPTSTGSAISLGDHQGLSSSLEDFLSNSGSVE----EGGEEIYVVMLEETQFSKTVSRLPTAA 267

  Fly   174 AESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAA--- 235
            .:                 :|:||.....:..|.::            ..:||...::..||   
Mouse   268 HQ-----------------ENAALSPGCAQSSELIL------------KRYDLIQEQHNYAAPPL 303

  Fly   236 -------AGGSGKKRRGKQIT------PVVKR------------KRRLAANARERRRMQNLNQAF 275
                   |....|.|....:.      |...|            :||...|..||:|...:..:|
Mouse   304 PYVDREDARPQKKPRSHTSLALKCVFRPKAPRLGSRNNSDWENIERRRNHNRMERQRRDIMRSSF 368

  Fly   276 DRLRQYLPCLGNDRQLSKHETLQMAQTYISAL 307
            ..||..:|.|.::.:.:|...|:.|..||..|
Mouse   369 LNLRDLVPELVHNEKAAKVVILKKATEYIHTL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 18/67 (27%)
MycsNP_034980.2 Myc_N 10..328 CDD:279405 27/153 (18%)
HLH 348..405 CDD:238036 17/53 (32%)
Leucine-zipper 400..421 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.