DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and ngn-1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_500236.1 Gene:ngn-1 / 177045 WormBaseID:WBGene00003595 Length:184 Species:Caenorhabditis elegans


Alignment Length:103 Identity:36/103 - (34%)
Similarity:55/103 - (53%) Gaps:5/103 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LFSGGEDFD-GNDGSFDLADGENQDAAAGGSGKKRRGKQITPV----VKRKRRLAANARERRRMQ 269
            |.:|.:|.| ..:...|.....:.........::.|.::.:|.    .|..||..|||||||||.
 Worm    12 LQTGEQDLDMERENDMDQNSKNSTQKPVKREKRRYRCRKRSPATIERAKTVRRDKANARERRRMN 76

  Fly   270 NLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISAL 307
            :||.|.:.||..||.|.::.:::|.|||:.||.||::|
 Worm    77 SLNDALEHLRGILPALPDEPKMTKIETLRKAQEYIASL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/55 (53%)
ngn-1NP_500236.1 bHLH_SF 63..119 CDD:381792 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.