DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Mesp1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus


Alignment Length:111 Identity:35/111 - (31%)
Similarity:52/111 - (46%) Gaps:20/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 DGND-----GSFDLADGENQDA----------AAGGSGKKRRGKQITPVVKRKRRLAANARERRR 267
            |||.     .|.|..||....:          .||..|  |||...:.:...:|: :|:.||:.|
Mouse    27 DGNSVCSPAWSSDPWDGAQASSPAPPCARPARRAGTPG--RRGTHGSRLGSGQRQ-SASEREKLR 88

  Fly   268 MQNLNQAFDRLRQYLP--CLGNDRQLSKHETLQMAQTYISALGDLL 311
            |:.|.:|...||::||  .....:.|:|.|||::|..||..|..:|
Mouse    89 MRTLARALHELRRFLPPSVAPTGQNLTKIETLRLAIRYIGHLSAVL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 22/61 (36%)
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 16/61 (26%)
HLH 77..130 CDD:278439 20/53 (38%)
CPLCP 153..157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.