DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Lyl1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_032561.2 Gene:Lyl1 / 17095 MGIID:96891 Length:278 Species:Mus musculus


Alignment Length:241 Identity:64/241 - (26%)
Similarity:88/241 - (36%) Gaps:77/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 AQNQQYGMIMEQSVVSTAPAIPVAS------------------PPAVEVMGSSNVGTCKTIPASA 148
            |..::..|:...|.....|:.|.:.                  ||.|.|:   |:|..:.|.| |
Mouse    13 AMTEKTEMVCASSPAPAPPSKPASPGPLSTEEVDHRNTCTPWLPPGVPVI---NLGHTRPIGA-A 73

  Fly   149 GPKPKRSYTKKNQPSTTA--TSTPTAAAESSASVNLYTEEFQN---------FD-FDNSALFDDS 201
            .|..:.|..:.:....||  .:.||.|      |:.:...|.|         |. |.||.|    
Mouse    74 MPTTELSAFRPSLLQLTALGRAPPTLA------VHYHPHPFLNSVYIGPAGPFSIFPNSRL---- 128

  Fly   202 VEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERR 266
                          ....:....|||||......|                   ||:..|:|||.
Mouse   129 --------------KRRPSHSELDLADGHQPQKVA-------------------RRVFTNSRERW 160

  Fly   267 RMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            |.|::|.||..||:.||....||:|||:|.|::|..||..|..|||
Mouse   161 RQQHVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 27/58 (47%)
Lyl1NP_032561.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 5/32 (16%)
bHLH_TS_LYL1 145..209 CDD:381548 30/81 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.