DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and BHLHA15

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_803238.1 Gene:BHLHA15 / 168620 HGNCID:22265 Length:189 Species:Homo sapiens


Alignment Length:78 Identity:35/78 - (44%)
Similarity:49/78 - (62%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 AAAGGSGKKRRGKQITPVVKR----KRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKH 294
            |.|.|.|::||.....|..:|    :|||.:|.|||:||..||.||..||:.:|.:..|::|||.
Human    50 ARAPGEGRRRRPGPSGPGGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKI 114

  Fly   295 ETLQMAQTYISAL 307
            |||.:|:.||.:|
Human   115 ETLTLAKNYIKSL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 28/59 (47%)
BHLHA15NP_803238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85 13/34 (38%)
HLH 81..127 CDD:197674 23/45 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..189
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.