DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Bhlhe23

DIOPT Version :10

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_542372.2 Gene:Bhlhe23 / 140489 MGIID:2153710 Length:223 Species:Mus musculus


Alignment Length:91 Identity:20/91 - (21%)
Similarity:35/91 - (38%) Gaps:18/91 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EIGNQYTYQMFDVEKASNSNHHLGFQNDPRMAYDKIIYTSTNKLGCNDFYYQCAYGEPKTD--RM 138
            ::|.:|.....|:..:..:|..  |..|.|..|:.::.:|...:..      ...|...||  |:
Mouse   277 DMGGEYYCYSSDITCSFPANGK--FTADQRTIYEAVLKSSRAVMAA------IKPGVKWTDMHRL 333

  Fly   139 AIRHKLD--------NDDIEPAAKRH 156
            |.|..|:        :.|:|...|.|
Mouse   334 ADRVHLEELLKIGILHGDVEEMLKVH 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558
Bhlhe23NP_542372.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..93
bHLH_TS_bHLHe22_bHLHb5 99..168 CDD:381524
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.