DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Bhlhe23

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_542372.2 Gene:Bhlhe23 / 140489 MGIID:2153710 Length:223 Species:Mus musculus


Alignment Length:196 Identity:51/196 - (26%)
Similarity:73/196 - (37%) Gaps:65/196 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 MGSSNVGTCKTIPASAGPKPKRSYTKK----NQPSTTATSTPTAAAESSASVNLYTEEFQNFDFD 193
            :..|...|.....|:.||:..|.:...    :.|:..|:..|.|..|||                
Mouse    15 LSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAAPASRVPAATVESS---------------- 63

  Fly   194 NSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQIT------PVV 252
                                ||.....|.:|:             ..::|||..:.      |..
Mouse    64 --------------------GEQSGDEDEAFE-------------RRRRRRGSGVAVDARRRPRE 95

  Fly   253 KRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKHETLQMAQTYI----SALGDLL 311
            :|..||:.||||||||.:||.|.|.||..:|...:.  |:|||..||.:|:.||    .||.::.
Mouse    96 QRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMR 160

  Fly   312 R 312
            |
Mouse   161 R 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/64 (45%)
Bhlhe23NP_542372.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..93 16/109 (15%)
HLH 104..158 CDD:197674 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.