DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and BHLHE23

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_542173.2 Gene:BHLHE23 / 128408 HGNCID:16093 Length:241 Species:Homo sapiens


Alignment Length:221 Identity:59/221 - (26%)
Similarity:80/221 - (36%) Gaps:77/221 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PVASPPAVEVMGSSNVGTCKTI-------------PASAG--------PKPKRSYTKK----NQP 162
            |...||:   .|.:.:...|::             .|:||        |:..|.|...    :.|
Human     5 PPGEPPS---PGGAAMAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLP 66

  Fly   163 STTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLA 227
            :..|...|..|||||...                               ||.||           
Human    67 AAPAPRAPAQAAESSGEQ-------------------------------SGDED----------- 89

  Fly   228 DGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQ 290
            |...|.....|.|....|:: .|..:|..||:.||||||||.:||.|.|.||..:|...:.  |:
Human    90 DAFEQRRRRRGPGSAADGRR-RPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRK 153

  Fly   291 LSKHETLQMAQTYI----SALGDLLR 312
            |||..||.:|:.||    .||.::.|
Human   154 LSKIATLLLAKNYILMQAQALDEMRR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/64 (45%)
BHLHE23NP_542173.2 bHLH_SF 111..191 CDD:412148 31/69 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.