DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and AgaP_AGAP009983

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_319121.4 Gene:AgaP_AGAP009983 / 1279405 VectorBaseID:AGAP009983 Length:380 Species:Anopheles gambiae


Alignment Length:365 Identity:82/365 - (22%)
Similarity:140/365 - (38%) Gaps:92/365 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEIYRYYYKTSE-DLQG--FKTAAAEPYFNPMAAYNPGVTHYQFNGNTLASSSNYLSANGFISFE 65
            |.:.:.|.|.|. :|..  .|.||........:.:|.|.:.::.:..:|..||.    :|.||.|
Mosquito     7 STLAKMYPKLSAVELSAILMKGAAMSASLERDSGFNSGSSEHEDDLKSLDQSSR----DGLISPE 67

  Fly    66 QASSDGWISSSPASHRSESPEYVDLNTMYNGGCNNMAQNQQYG-----MIMEQSVV--------- 116
            .:|.|    |.|.:..|.:      ..:.....:::.:|::..     ::.|..::         
Mosquito    68 NSSED----SVPEAKLSST------GVVVTAQASSLVKNKRKSTEPLRVVAETELLAPLKKRIRF 122

  Fly   117 ----------STAPAIPVASPP----AVEVMGSSNVGTCKTIP-ASAGPKP-------------K 153
                      |.||:...||.|    |...|..........:| ||..|.|             .
Mosquito   123 DDERKHLDTSSPAPSCRTASSPFRPWAPSAMTLEGGPISHPVPFASPFPNPADLLVRHPAVTTLH 187

  Fly   154 RSYTKKN----QPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALF------------DDSV 202
            |:.:.|.    ||........:|::.||.|.:.......:....:..||            :||:
Mosquito   188 RAVSIKPLEQLQPLALVAKKSSASSSSSTSSSNQHAHLHHSHASSGPLFVQPRAPPSLDGTNDSI 252

  Fly   203 EDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRR 267
            .|.|..:. |||.            .|::...:.|...:.|..|.:|    |:||:.||||||.|
Mosquito   253 TDHESTVA-SGGH------------GGKSSSGSGGAISQTRNYKNMT----RERRIEANARERTR 300

  Fly   268 MQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISAL 307
            :..::.|:::||:.:|...|.::|||...|::|.:||..|
Mosquito   301 VHTISAAYEKLRRAIPAYSNAQKLSKLSILRIACSYILTL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 23/55 (42%)
AgaP_AGAP009983XP_319121.4 HLH 289..340 CDD:278439 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.