DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and AgaP_AGAP007822

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_317679.2 Gene:AgaP_AGAP007822 / 1278137 VectorBaseID:AGAP007822 Length:69 Species:Anopheles gambiae


Alignment Length:57 Identity:43/57 - (75%)
Similarity:49/57 - (85%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 KRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            |||||||||||:||.:||.||||||:.:|.||.|.:|||.||||||||||:||.|||
Mosquito     1 KRRLAANARERKRMNSLNVAFDRLREIVPSLGPDHKLSKFETLQMAQTYINALSDLL 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 43/57 (75%)
AgaP_AGAP007822XP_317679.2 HLH 1..58 CDD:238036 43/57 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124435at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.