DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurog3

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_033849.3 Gene:Neurog3 / 11925 MGIID:893591 Length:214 Species:Mus musculus


Alignment Length:98 Identity:41/98 - (41%)
Similarity:51/98 - (52%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 DLADGENQDAAAGGSGKK---RRGKQITP-------VVKRKRRLAANARERRRMQNLNQAFDRLR 279
            |.::.|..|..  |:.:|   |||.:..|       ..:|.||..||.|||.||.|||.|.|.||
Mouse    45 DCSEAEVGDCR--GTSRKLRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALR 107

  Fly   280 QYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            ..||...:|.:|:|.|||:.|..||.||...||
Mouse   108 GVLPTFPDDAKLTKIETLRFAHNYIWALTQTLR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 30/58 (52%)
Neurog3NP_033849.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98 19/54 (35%)
HLH 81..140 CDD:238036 30/58 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.