DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurog2

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_033848.1 Gene:Neurog2 / 11924 MGIID:109619 Length:263 Species:Mus musculus


Alignment Length:136 Identity:49/136 - (36%)
Similarity:63/136 - (46%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 SVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSG-------------KKR--------R 244
            |.:::||..|...| ...|..|: :...|.....|:|..|             |:|        |
Mouse    36 SADEEEDEELRRPG-SARGQRGA-EAGQGVQGSPASGAGGCRPGRLLGLMHECKRRPSRSRAVSR 98

  Fly   245 GKQITPVV---KRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISA 306
            |.:....|   |:.|||.||.|||.||.|||.|.|.||:.||....|.:|:|.|||:.|..||.|
Mouse    99 GAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWA 163

  Fly   307 LGDLLR 312
            |.:.||
Mouse   164 LTETLR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 31/58 (53%)
Neurog2NP_033848.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..76 11/41 (27%)
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 34/66 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..253
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.