DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurod4

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus


Alignment Length:118 Identity:44/118 - (37%)
Similarity:60/118 - (50%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 DSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVK------RKRRL 258
            ||:|:||:                      |.:|    |...||||.:...:.|      |.||:
Mouse    52 DSIEEDEE----------------------EEED----GDKPKRRGPKKKKMTKARLERFRARRV 90

  Fly   259 AANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            .||||||.||..||.|.|.||:.:||....::|||.|||::|:.||.||.::|
Mouse    91 KANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 32/65 (49%)
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 12/53 (23%)
HLH 88..144 CDD:238036 30/56 (54%)
Neuro_bHLH 146..263 CDD:289310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.