DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Neurod6

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_033847.1 Gene:Neurod6 / 11922 MGIID:106593 Length:337 Species:Mus musculus


Alignment Length:151 Identity:48/151 - (31%)
Similarity:73/151 - (48%) Gaps:35/151 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FDNSALFDDS---------VEDDEDL---------MLFSG-------GEDFDGNDGSFDLADGEN 231
            ||.|.:..:|         .||.:.:         ::..|       ||:.:..:   :..|.|.
Mouse     6 FDESVVMPESQMCRKFARQCEDQKQIKKPESFPKQVVLRGKSIKRAPGEETEKEE---EEEDREE 67

  Fly   232 QDAAAGGSGKKR--RGKQITPVVKRK---RRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQL 291
            :|  ..|..::|  |.|:.|.:...:   ||..||||||.||..||.|.|.||:.:||....::|
Mouse    68 ED--ENGLSRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKL 130

  Fly   292 SKHETLQMAQTYISALGDLLR 312
            ||.|||::|:.||.||.::||
Mouse   131 SKIETLRLAKNYIWALSEILR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/61 (48%)
Neurod6NP_033847.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..80 8/56 (14%)
Nuclear localization signal. /evidence=ECO:0000255 80..86 2/5 (40%)
bHLH_TS_NeuroD6_ATOH2 82..151 CDD:381565 31/68 (46%)
Neuro_bHLH 153..272 CDD:372170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.