DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and Atoh1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus


Alignment Length:182 Identity:62/182 - (34%)
Similarity:85/182 - (46%) Gaps:20/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PKPKRSYTKKNQP----------ST--TATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSV 202
            |:|..:...::.|          ||  .|..|||.....:|....|...........:|...|..
Mouse    33 PQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEA 97

  Fly   203 EDDEDLMLFSGGEDFDGNDGSF-------DLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAA 260
            :...:|:..||......:.|..       .|..|...|.......:....||:.. |:::|||||
Mouse    98 DSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNG-VQKQRRLAA 161

  Fly   261 NARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            ||||||||..||.|||:||..:|...||::|||:|||||||.||:||.:||:
Mouse   162 NARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 38/58 (66%)
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 5/26 (19%)
HLH 155..213 CDD:238036 38/57 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835487
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.