DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and neurod6b

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001296772.1 Gene:neurod6b / 114415 ZFINID:ZDB-GENE-010608-2 Length:332 Species:Danio rerio


Alignment Length:139 Identity:45/139 - (32%)
Similarity:68/139 - (48%) Gaps:14/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 LYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKR--- 243
            :.|..|:..|....:.|..:....||:...|..|..:..|.:.|..:.|.::....|..||:   
Zfish    16 MLTVPFEEPDMMRESQFGATFTRQEDVRTLSSAELKEAEDDNTDREEEEEREEDENGLPKKKGPR 80

  Fly   244 ------RGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQT 302
                  ||.::     :.||..||||||.||..||.|.:.||:.:||....::|||.|||::|:.
Zfish    81 KKKSEGRGDRV-----KMRRQEANARERSRMHGLNDALESLRKVVPCYSKTQKLSKIETLRLAKN 140

  Fly   303 YISALGDLL 311
            ||.||.:.|
Zfish   141 YIWALSETL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 29/59 (49%)
neurod6bNP_001296772.1 HLH 92..150 CDD:238036 29/58 (50%)
Neuro_bHLH 152..271 CDD:289310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.