DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and neurod6a

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_017209288.1 Gene:neurod6a / 114414 ZFINID:ZDB-GENE-010608-1 Length:391 Species:Danio rerio


Alignment Length:127 Identity:50/127 - (39%)
Similarity:65/127 - (51%) Gaps:16/127 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 EEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGKQIT 249
            |.|:..:..:..:.||..|.|||       |..||.|        ||......|..||:..|...
Zfish    98 EPFEKEETLSHVMDDDDSEKDED-------EREDGQD--------ENGLPRRRGPRKKKMTKARV 147

  Fly   250 PVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            ..|| .||:.||||||.||..||.|.|.||:.:||....::|||.|||::|:.||.||.::|
Zfish   148 DRVK-VRRMEANARERNRMHGLNNALDSLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 31/59 (53%)
neurod6aXP_017209288.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.