powered by:
Protein Alignment ato and AgaP_AGAP013406
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003436908.1 |
Gene: | AgaP_AGAP013406 / 11175595 |
VectorBaseID: | AGAP013406 |
Length: | 129 |
Species: | Anopheles gambiae |
Alignment Length: | 74 |
Identity: | 33/74 - (44%) |
Similarity: | 46/74 - (62%) |
Gaps: | 7/74 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 234 AAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQ 298
:.:|.||| .|.:...:||.||||||.|..::|.||:.||..:|....||:|||.|||:
Mosquito 10 STSGDSGK-------DPQLTFDQRLQANARERYRTHSVNSAFNNLRLLIPTEPPDRKLSKIETLR 67
Fly 299 MAQTYISAL 307
:|::|||.|
Mosquito 68 LAKSYISHL 76
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ato | NP_731223.1 |
HLH |
253..312 |
CDD:238036 |
28/55 (51%) |
AgaP_AGAP013406 | XP_003436908.1 |
HLH |
25..76 |
CDD:278439 |
27/50 (54%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000894 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.