Sequence 1: | NP_731223.1 | Gene: | ato / 40975 | FlyBaseID: | FBgn0010433 | Length: | 312 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005797.1 | Gene: | OLIG2 / 10215 | HGNCID: | 9398 | Length: | 323 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 57/206 - (27%) |
---|---|---|---|
Similarity: | 89/206 - (43%) | Gaps: | 43/206 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 MIMEQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTATSTPT-A 172
Fly 173 AAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAG 237
Fly 238 GSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGND--RQLSKHETLQMA 300
Fly 301 QTYISALGDLL 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ato | NP_731223.1 | HLH | 253..312 | CDD:238036 | 26/61 (43%) |
OLIG2 | NP_005797.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..107 | 31/145 (21%) | |
bHLH_TS_OLIG2 | 95..179 | CDD:381510 | 31/73 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165145409 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |