powered by:
Protein Alignment ato and atoh1c
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003199618.1 |
Gene: | atoh1c / 100498672 |
ZFINID: | ZDB-GENE-090805-1 |
Length: | 204 |
Species: | Danio rerio |
Alignment Length: | 59 |
Identity: | 41/59 - (69%) |
Similarity: | 48/59 - (81%) |
Gaps: | 0/59 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 253 KRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
:|:|||||||||||||..||.||||||..:|.:.:||:|||.|||||||.|||.|.:||
Zfish 69 RRRRRLAANARERRRMLGLNVAFDRLRSVIPNVESDRKLSKSETLQMAQIYISTLSELL 127
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ato | NP_731223.1 |
HLH |
253..312 |
CDD:238036 |
41/59 (69%) |
atoh1c | XP_003199618.1 |
HLH |
87..129 |
CDD:197674 |
27/41 (66%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170578687 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4395 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR19290 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.