powered by:
Protein Alignment ato and atoh7
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012822645.1 |
Gene: | atoh7 / 100493495 |
XenbaseID: | XB-GENE-989022 |
Length: | 115 |
Species: | Xenopus tropicalis |
Alignment Length: | 57 |
Identity: | 38/57 - (66%) |
Similarity: | 46/57 - (80%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 255 KRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
|||:|||||||||||.||.|||.||:.:|..|.|::|||:||||||.:||.||..:|
Frog 10 KRRMAANARERRRMQGLNTAFDSLRKVVPQWGEDKKLSKYETLQMALSYIMALNRIL 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ato | NP_731223.1 |
HLH |
253..312 |
CDD:238036 |
38/57 (67%) |
atoh7 | XP_012822645.1 |
HLH |
16..68 |
CDD:197674 |
33/51 (65%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR19290 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2611 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.040 |
|
Return to query results.
Submit another query.