DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and neurog2

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_002934289.2 Gene:neurog2 / 100493110 XenbaseID:XB-GENE-491040 Length:213 Species:Xenopus tropicalis


Alignment Length:160 Identity:44/160 - (27%)
Similarity:71/160 - (44%) Gaps:25/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 KRSYTKKNQPSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDF 217
            |..|..:.:..|:|:....:::..|.:....:::.|.....:.||.....::.            
 Frog     5 KCEYRDEEEELTSASPCSVSSSHMSPAQTCSSDDEQLLSPTSPALMHLQAQEQ------------ 57

  Fly   218 DGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYL 282
                        ||...:.....:.:.|:.:.. ||:.||:.||.|||.||.:||.|.|.||:.|
 Frog    58 ------------ENSPPSRRSRPRTKNGETVLK-VKKTRRIKANNRERNRMHHLNSALDSLREVL 109

  Fly   283 PCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            |.|..|.:|:|.|||:.|..||.||.:.||
 Frog   110 PSLPEDAKLTKIETLRFAYNYIWALSETLR 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 30/58 (52%)
neurog2XP_002934289.2 bHLH_TS_NGN2_ATOH4 74..142 CDD:381560 33/67 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.