DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and atoh8

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_002937330.2 Gene:atoh8 / 100490889 XenbaseID:XB-GENE-877027 Length:246 Species:Xenopus tropicalis


Alignment Length:267 Identity:57/267 - (21%)
Similarity:87/267 - (32%) Gaps:108/267 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NGFISF------EQASSDG------WISSSPASHRSESPEYVDL--NTMYNGGCNNMAQNQQYGM 109
            ||..||      ::|.::|      .:....|..|....:.:||  |.:|.|....|...:..|.
 Frog    37 NGLKSFKVDLKVDEAPAEGRTGQQQELLGGRAGERVLGGDVLDLRNNGLYPGKKGLMKSRELEGQ 101

  Fly   110 IMEQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASAGP-KPKRSYTKKNQPSTTATSTPTAA 173
            ...:.|:  .||.|   ||....           :||...| .|..|.:.:|:...||       
 Frog   102 QQPRMVI--CPARP---PPETPY-----------LPAPQAPYSPDPSASPRNRLGETA------- 143

  Fly   174 AESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGG 238
                                                                   |.|.:..|  
 Frog   144 -------------------------------------------------------GVNSEIKA-- 151

  Fly   239 SGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTY 303
                         :::.|||.||||||.|:..::.||:.||:.:||....::|||...|::|..|
 Frog   152 -------------IQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNY 203

  Fly   304 ISALGDL 310
            |.:|..|
 Frog   204 ILSLARL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 25/58 (43%)
atoh8XP_002937330.2 bHLH_TS_ATOH8 149..216 CDD:381427 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.