DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and tal1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001135468.1 Gene:tal1 / 100196924 XenbaseID:XB-GENE-479827 Length:388 Species:Xenopus tropicalis


Alignment Length:325 Identity:72/325 - (22%)
Similarity:109/325 - (33%) Gaps:113/325 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ISSSPASHRSESPE----------------------YVDLNTMYNGGCNNMAQNQQYGMIMEQSV 115
            ::|.||...:..||                      .::|:....|..|..|:.|:..:   ||:
 Frog    15 VASPPAQQDAAEPERTVELSGVKEGAAPNSPPRAVPVIELHRRGEGSGNIKAREQELRL---QSI 76

  Fly   116 VST-------------------------------------APAIPVAS------PPAVEVMGSS- 136
            .:|                                     ||..|...      .||.|:..:| 
 Frog    77 RTTELCRAPLTLATELCRAPLTPTTELCRAPLTPTTELCRAPLTPTTELCRPPLTPAAELCRASL 141

  Fly   137 --NVGTCKTIPASAGPKPKRSYTKKNQPSTTATST----------------PTAA--AESSASVN 181
              ....|:...:..|| |....|:..:|.....||                |||:  .:::....
 Frog   142 TPAAELCRAPSSVTGP-PLTVTTELCRPPIPLPSTGPPAEQAVEARMVQLSPTASLPLQAAGRTM 205

  Fly   182 LYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGK 246
            ||... |.....||..||    |.|...:|:.........|.:::...|.               
 Frog   206 LYGLN-QTLASGNSGYFD----DPEAYPMFTNNSRVKRRPGPYEVEISEG--------------- 250

  Fly   247 QITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
               |..|..||:..|:|||.|.||:|.||..||:.:|....|::|||:|.|::|..||:.|..||
 Frog   251 ---PQTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLL 312

  Fly   312  311
             Frog   313  312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 28/59 (47%)
tal1NP_001135468.1 PHA03247 <6..195 CDD:223021 30/183 (16%)
bHLH_TS_TAL1 254..318 CDD:381549 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.