DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and tcf12

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_004912760.1 Gene:tcf12 / 100188922 XenbaseID:XB-GENE-5799694 Length:716 Species:Xenopus tropicalis


Alignment Length:241 Identity:61/241 - (25%)
Similarity:94/241 - (39%) Gaps:74/241 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GVTHYQFNGNTLASSSNYLSANGFISFEQASSDGWISSSPASHRSESPEYVDLNTMYNGGCNNMA 102
            |..|   ||...:.:|||.:| |.::..:.:     |...|:||.||   |.:::          
 Frog   468 GAAH---NGPIASLTSNYGTA-GLVANSRQT-----SMQVANHREES---VSISS---------- 510

  Fly   103 QNQQYGMIMEQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSYTKKNQPSTTAT 167
                     |.||:|:..:   ||.|.:.                  .||:.:| :......||.
 Frog   511 ---------EHSVLSSTVS---ASNPEIT------------------HKPQENY-RALSGVLTAQ 544

  Fly   168 STPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQ 232
            |..:..||....   :.|:.:|.....|:  ||...|||     |..:||..:.|.   ....|:
 Frog   545 SVISNLAEIKTE---HKEKDENIHDGVSS--DDMKSDDE-----SSQKDFKSSRGR---TSSINE 596

  Fly   233 DAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRL 278
            |.......|..|.|:        ||:|.|||||.|::::|:||..|
 Frog   597 DEDLNPEQKLEREKE--------RRMANNARERLRVRDINEAFKEL 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 13/26 (50%)
tcf12XP_004912760.1 bHLH_E-protein_TCF4_E2-2 605..689 CDD:381515 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.