DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and neurog1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001116895.1 Gene:neurog1 / 100144651 XenbaseID:XB-GENE-491452 Length:227 Species:Xenopus tropicalis


Alignment Length:126 Identity:41/126 - (32%)
Similarity:57/126 - (45%) Gaps:4/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 DFDNSALFDDSVEDDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGSGKKRRGK----QITPV 251
            |::..:.......|:||.........|.....|......|..........|:.|.:    .:...
 Frog     7 DYETCSQMSYCSSDEEDSFSMQSASPFSSEHMSSPAQTPEKCQEEKDKRKKRVRSRVKNDAVLHT 71

  Fly   252 VKRKRRLAANARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLLR 312
            :|:.||:.||.|||.||.|||.|.|.||..||...:|.:|:|.|||::|..||.||.:.||
 Frog    72 IKKTRRVKANDRERNRMHNLNSALDELRGILPSFPDDTKLTKIETLRLAHNYIWALSETLR 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 30/58 (52%)
neurog1NP_001116895.1 HLH 73..132 CDD:238036 30/58 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.