DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and neurod4

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001124513.1 Gene:neurod4 / 100124310 XenbaseID:XB-GENE-972704 Length:316 Species:Xenopus tropicalis


Alignment Length:100 Identity:41/100 - (41%)
Similarity:55/100 - (55%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 DGNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVK------RKRRLAANARERRRMQNLNQAFD 276
            ||.|...:..|||.         .|:||.:...:.|      |.||:.||||||.||..||.|.:
 Frog    45 DGEDDDEEEEDGEK---------PKKRGPKKKKMTKARLERFRVRRVKANARERTRMHGLNDALE 100

  Fly   277 RLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
            .||:.:||....::|||.|||::|:.||.||.|:|
 Frog   101 NLRRVMPCYSKTQKLSKIETLRLARNYIWALSDIL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 31/64 (48%)
neurod4NP_001124513.1 bHLH_TS_NeuroD4_ATOH3 <69..137 CDD:381564 31/66 (47%)
Neuro_bHLH 138..256 CDD:372170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.