powered by:
Protein Alignment ato and mespab
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001252512.1 |
Gene: | mespab / 100006128 |
ZFINID: | ZDB-GENE-090817-2 |
Length: | 240 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 30/73 - (41%) |
Similarity: | 45/73 - (61%) |
Gaps: | 5/73 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 242 KRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLP--CLGNDRQLSKHETLQMAQTYI 304
|||.:...|.:||: :|:.||:.||::|.:|...||.:|| .....:.|:|.|||::|.:||
Zfish 80 KRRSRSKNPGMKRQ---SASEREKLRMRDLTKALHHLRSFLPPSVAPAGQTLTKIETLRLAISYI 141
Fly 305 SALGDLLR 312
|.|.|.||
Zfish 142 SHLSDQLR 149
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ato | NP_731223.1 |
HLH |
253..312 |
CDD:238036 |
24/60 (40%) |
mespab | NP_001252512.1 |
HLH |
91..144 |
CDD:278439 |
22/55 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.