powered by:
Protein Alignment ato and tcf23
DIOPT Version :9
Sequence 1: | NP_731223.1 |
Gene: | ato / 40975 |
FlyBaseID: | FBgn0010433 |
Length: | 312 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001342593.4 |
Gene: | tcf23 / 100002924 |
ZFINID: | ZDB-GENE-090806-5 |
Length: | 277 |
Species: | Danio rerio |
Alignment Length: | 50 |
Identity: | 23/50 - (46%) |
Similarity: | 32/50 - (64%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 262 ARERRRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALGDLL 311
||||.|::||.|||..|:..||.:..|.:|||.:.|.:|..||:.|.:.|
Zfish 170 ARERSRVRNLRQAFHSLQAALPSVPPDTKLSKLDVLVLATNYIAHLTETL 219
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ato | NP_731223.1 |
HLH |
253..312 |
CDD:238036 |
22/49 (45%) |
tcf23 | XP_001342593.4 |
HLH |
170..221 |
CDD:197674 |
22/49 (45%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.