DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ato and olig1

DIOPT Version :9

Sequence 1:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001018632.1 Gene:olig1 / 100001484 ZFINID:ZDB-GENE-050107-2 Length:235 Species:Danio rerio


Alignment Length:107 Identity:31/107 - (28%)
Similarity:49/107 - (45%) Gaps:25/107 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 GENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYL----------- 282
            |.|..:..|.....:..::::...:::.|...|:|||:|||:||.|.|.||:.:           
Zfish    34 GSNVGSLQGPLRSSKPPRELSSEEQQELRRKINSRERKRMQDLNVAMDALREVMVPYSSSPTGVG 98

  Fly   283 ------------PCLGNDRQLSKHETLQMAQTYISALGDLLR 312
                        |..|  |:|||..||.:|:.||..||..|:
Zfish    99 GALQHPYFPPGAPTTG--RRLSKISTLVLARNYILLLGSSLQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoNP_731223.1 HLH 253..312 CDD:238036 27/81 (33%)
olig1NP_001018632.1 HLH domain 62..139 28/79 (35%)
HLH 62..133 CDD:278439 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.