DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9630 and DDX56

DIOPT Version :9

Sequence 1:NP_649777.1 Gene:CG9630 / 40974 FlyBaseID:FBgn0037561 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_061955.1 Gene:DDX56 / 54606 HGNCID:18193 Length:547 Species:Homo sapiens


Alignment Length:624 Identity:165/624 - (26%)
Similarity:248/624 - (39%) Gaps:179/624 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSDAVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLVPMLEILQRRHKETPW 78
            |...:||.|...|:.:.|.:|..||||.|..||:.|.|.||||||.|:.:|||::|..|....|.
Human    14 LDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAAYAIPMLQLLLHRKATGPV 78

  Fly    79 GPKEIGALVISPTRELARQISEVLAQFLEHEDLEHLNQQLIVGGNSIEEDIATLR---RETPCIL 140
            ..:.:..||:.||:|||||...::.|.     ..:..:.:.|...|..||..:.|   .|.|.::
Human    79 VEQAVRGLVLVPTKELARQAQSMIQQL-----ATYCARDVRVANVSAAEDSVSQRAVLMEKPDVV 138

  Fly   141 VCTPGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTGLFSA 205
            |.||.|:....|:  |.|.|.   .|||.||:||||.|...||:..:.::|.:|||..:..|.||
Human   139 VGTPSRILSHLQQ--DSLKLR---DSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSA 198

  Fly   206 TQTTEVTDLIRAGLRNPVLVSVKEKASVNTPARLQNFYRIVEPELKFVALLEFLSSPATVIGKVM 270
            |...:|..|....|.|||.:.::| :.:..|.:||.|..:.|.|.....||..|...:.:.||.:
Human   199 TFNEDVQALKELILHNPVTLKLQE-SQLPGPDQLQQFQVVCETEEDKFLLLYALLKLSLIRGKSL 262

  Fly   271 VF------------------FPTCACVEYWAEALPPLLPKRTVLGIHGKMKNKRANVVEKFRNTP 317
            :|                  .|||        .|...||.|:           |.:::.:|....
Human   263 LFVNTLERSYRLRLFLEQFSIPTC--------VLNGELPLRS-----------RCHIISQFNQGF 308

  Fly   318 QAVLLCTDV---------------------------LARGLDVPEIEWVVQWDPPSTASSFVHRV 355
            ...::.||.                           :|||:|...:..|:.:|.|.|..:::||.
Human   309 YDCVIATDAEVLGAPVKGKRRGRGPKGDKASDPEAGVARGIDFHHVSAVLNFDLPPTPEAYIHRA 373

  Fly   356 GRTARQGNEGNALVFLLPSEDAYVHFLKINQKVELTKLLTEEAEDADREKKKLPAVLDQLHRLQA 420
            |||||..|.|..|.|:||:|.  .|..||.:      ||:.|        .:.|.:|....|::.
Human   374 GRTARANNPGIVLTFVLPTEQ--FHLGKIEE------LLSGE--------NRGPILLPYQFRMEE 422

  Fly   421 ADKGVYDKGMRAFVSHVRAYTKHECSAILRLKDLDLGKMATAYGLLQLPRMPELKNYQGGGYVAP 485
            .:      |.|           :.|...:|    .:.|.|     ::..|:.|:|          
Human   423 IE------GFR-----------YRCRDAMR----SVTKQA-----IREARLKEIK---------- 451

  Fly   486 AFEVDLSKLTYKNAQKEQVRQKKMETY-----------------------EQTGSWPGQ------ 521
                           :|.:..:|::||                       ...|..|..      
Human   452 ---------------EELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPAL 501

  Fly   522 ----KQHKKRVESWDQTKKAKLDAKSKKELRKAKKQRKK 556
                :.||||.:.....:||| .|||:..||..|.:.||
Human   502 RGLVRPHKKRKKLSSSCRKAK-RAKSQNPLRSFKHKGKK 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9630NP_649777.1 DEADc 6..226 CDD:238167 80/214 (37%)
DEXDc 22..232 CDD:214692 78/212 (37%)
HELICc 239..370 CDD:238034 40/175 (23%)
DUF4217 411..470 CDD:290667 8/58 (14%)
DDX56NP_061955.1 Q motif 7..35 6/20 (30%)
SrmB 9..513 CDD:223587 154/595 (26%)
DEADc_DDX56 14..220 CDD:350719 80/215 (37%)
DEAD box 166..169 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 506..547 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.