DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9630 and Ddx56

DIOPT Version :9

Sequence 1:NP_649777.1 Gene:CG9630 / 40974 FlyBaseID:FBgn0037561 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_080814.1 Gene:Ddx56 / 52513 MGIID:1277172 Length:546 Species:Mus musculus


Alignment Length:645 Identity:166/645 - (25%)
Similarity:251/645 - (38%) Gaps:180/645 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSDAVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLVPMLEILQRRHKETPW 78
            |...:||.|...|:.:.|.:|..||||.|..||:.|.|.||||||.|:.:|||:.|..:....|.
Mouse    14 LDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAAYAIPMLQSLLHKKATGPV 78

  Fly    79 GPKEIGALVISPTRELARQISEVLAQFLEHEDLEHLNQQLIVGGNSIEEDIATLR---RETPCIL 140
            ..:.:..||:.||:|||||...::.|.     ..:..:.:.|...|..||.|:.|   .|.|.::
Mouse    79 MEQAVRGLVLVPTKELARQAQAMIQQL-----AAYCARDVRVANVSAAEDSASQRAVLMEKPDVV 138

  Fly   141 VCTPGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTGLFSA 205
            |.||.|:....|:     |......|||.||:||||.|...||:..:.::|.:|||..:..|.||
Mouse   139 VGTPSRVLSHLQQ-----NTLKLRDSLELLVVDEADLLFSFGFEDELKSLLCHLPRIYQAFLMSA 198

  Fly   206 TQTTEVTDLIRAGLRNPVLVSVKEKASVNTPARLQNFYRIVEPELKFVALLEFLSSPATVIGKVM 270
            |...:|..|....|.|||.:.::| :.:..|.:||.|..:.|.|.....||..|...:.:.||.:
Mouse   199 TFNEDVQTLKELVLHNPVTLKLQE-SQLPGPDQLQQFQVVCETEEDKFLLLYALLKLSLIRGKAL 262

  Fly   271 VF------------------FPTCACVEYWAEALPPLLPKRTVLGIHGKMKNKRANVVEKFRNTP 317
            :|                  .|:|        .|...||.|:           |.:::.:|....
Mouse   263 LFVNTLERGYRLRLFLEQFSIPSC--------VLNGELPLRS-----------RCHIISQFNQGL 308

  Fly   318 QAVLLCTDV---------------------------LARGLDVPEIEWVVQWDPPSTASSFVHRV 355
            ...::.||.                           :|||:|...:..|:.:|.|.||.::|||.
Mouse   309 YDCVIATDAEILGPQVKGKRRGRGSKGNKASDPESGVARGIDFHHVSAVLNFDLPPTAEAYVHRA 373

  Fly   356 GRTARQGNEGNALVFLLPSEDAYVHFLKINQKVELTKLLTEEAEDADREKKKLPAVLDQLHRLQA 420
            |||||..|.|..|.|:||:|..::      .|:|  .||:.|.|        .|.:|....:::.
Mouse   374 GRTARANNPGIVLTFVLPAEQPFL------GKIE--DLLSGEGE--------APILLPYQFQMEE 422

  Fly   421 ADKGVYDKGMRAFVSHVRAYTKHECSAILRLKDLDLGKMATAYGLLQLPRMPELKNYQGGGYVAP 485
            .:.                 .::.|...:|    .:.|.|     ::..|:.|:|          
Mouse   423 IES-----------------FRYRCRDAMR----SVTKQA-----IREARLKEIK---------- 451

  Fly   486 AFEVDLSKLTYKNAQKEQVRQKKMETYEQTGSWPGQ-------------KQHKKRVESWDQTKKA 537
                           :|.:..:|::||.:......|             |.|...|.        
Mouse   452 ---------------EELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVP-------- 493

  Fly   538 KLDAKSKKELRKAKKQRKKAAEAEASRSGKGKKRQQFSQEDLDELASDIRLFK-RLKKNK 596
              |......||.....|||..:...||..|..|.|           :.:|.|| |.||.|
Mouse   494 --DYLVPAALRGLVHPRKKRRKVPFSRKAKKVKAQ-----------NPLRDFKHRGKKPK 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9630NP_649777.1 DEADc 6..226 CDD:238167 78/214 (36%)
DEXDc 22..232 CDD:214692 76/212 (36%)
HELICc 239..370 CDD:238034 41/175 (23%)
DUF4217 411..470 CDD:290667 5/58 (9%)
Ddx56NP_080814.1 Q motif 7..35 6/20 (30%)
SrmB 9..544 CDD:223587 166/645 (26%)
P-loop_NTPase 9..219 CDD:304359 78/214 (36%)
DEAD box 166..169 2/2 (100%)
HELICc 234..388 CDD:238034 39/172 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..344 0/19 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..546 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.