DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9630 and CG7878

DIOPT Version :9

Sequence 1:NP_649777.1 Gene:CG9630 / 40974 FlyBaseID:FBgn0037561 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_649767.1 Gene:CG7878 / 40959 FlyBaseID:FBgn0037549 Length:703 Species:Drosophila melanogaster


Alignment Length:441 Identity:132/441 - (29%)
Similarity:222/441 - (50%) Gaps:67/441 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PPLSDAV-------------LQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLV 63
            ||:.:.|             |:.:...||.:.:|:|:.|.|:||...|:...|.||:|||||||:
  Fly   275 PPIPNPVWTFEQCFAEYPDMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLL 339

  Fly    64 PMLEILQRRHKETPWGPKEIGA--LVISPTRELARQISEVLAQFLEHEDLEHLNQQLIVGGNSIE 126
            |  .::...::.||.|.:. ||  ||::||||||.||...:.::    ....:....:.||.:..
  Fly   340 P--GMIHTEYQSTPRGTRG-GANVLVLAPTRELALQIEMEVKKY----SFRGMKAVCVYGGGNRN 397

  Fly   127 EDIATLRRETPCILVCTPGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNIL 191
            ..|:.|.|... |::||||||.||......|      |.::.:||||||||:||:||:..:..::
  Fly   398 MQISDLERGAE-IIICTPGRLNDLIMANVID------VSTITYLVLDEADRMLDMGFEPQIRKVM 455

  Fly   192 GYLPRQRRTGLFSATQTTEVTDLIRAGLRNPVLVSVKEKASVNTPA--RLQNFYRIVEPEL-KFV 253
            ..:...|:|.:.|||....|..|.::.::||:.|.|   .|::..|  .::...:::|.:: ||.
  Fly   456 LDIRPDRQTIMTSATWPPGVRRLAQSYMKNPIQVCV---GSLDLAATHSVKQIIKLMEDDMDKFN 517

  Fly   254 ALLEFLSSPATVIGKVMVFFPTCACVEYWAEALPPLLPKRTVLG-----IHG-KMKNKRANVVEK 312
            .:..|:.:.::. .|:::|   |. .:..|:.|...|   |:.|     ||| :.:..|...:..
  Fly   518 TITSFVKNMSST-DKIIIF---CG-RKVRADDLSSEL---TLDGFMTQCIHGNRDQMDREQAIAD 574

  Fly   313 FRNTPQAVLLCTDVLARGLDVPEIEWVVQWDPPSTASSFVHRVGRTARQGNEGNALVFLLPSEDA 377
            .::....:|:.|||.:||||:.:|..|:.:|.|.....:|||||||.|.|.:|.::.|....:.|
  Fly   575 IKSGVVRILVATDVASRGLDIEDITHVINYDFPHNIEEYVHRVGRTGRAGRQGTSISFFTREDWA 639

  Fly   378 YVHFLKINQKVELTKLLTEEAEDADREKKKLPAVLDQLHRLQAADKGVYDK 428
                        :.|.|.|..::|::|      |.|:||.:....|.:.||
  Fly   640 ------------MAKELIEILQEAEQE------VPDELHNMARRFKAMKDK 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9630NP_649777.1 DEADc 6..226 CDD:238167 76/228 (33%)
DEXDc 22..232 CDD:214692 74/211 (35%)
HELICc 239..370 CDD:238034 38/137 (28%)
DUF4217 411..470 CDD:290667 7/18 (39%)
CG7878NP_649767.1 KH-I 92..150 CDD:238053
DEADc 288..489 CDD:238167 73/214 (34%)
DEXDc 298..505 CDD:214692 76/223 (34%)
Helicase_C 514..624 CDD:278689 35/117 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.