DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9630 and Ddx1

DIOPT Version :9

Sequence 1:NP_649777.1 Gene:CG9630 / 40974 FlyBaseID:FBgn0037561 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_524212.2 Gene:Ddx1 / 40457 FlyBaseID:FBgn0015075 Length:727 Species:Drosophila melanogaster


Alignment Length:364 Identity:93/364 - (25%)
Similarity:151/364 - (41%) Gaps:79/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KETPWGPKEIGALVISPTRELARQISEVLAQFLEHEDLEHLNQQLIVGGNSIEEDIATLRRETPC 138
            |..|..|:   |:::.|:||||.|....:.:|..|.....:...|::||..:||..|.|.:.|. 
  Fly   281 KPAPNAPQ---AIIMEPSRELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTH- 341

  Fly   139 ILVCTPGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPRQRRTG-- 201
            |:|.||||||::.   ...|.|....:   |.||||||.||..|:...::.:...:|:....|  
  Fly   342 IVVGTPGRLEEMI---NSGLVLLTHCR---FFVLDEADALLKQGYTELIDRLHKQIPKITSDGRR 400

  Fly   202 ----LFSAT-QTTEVTDLIRAGLRNPVLVSVKEKASVNTPARLQNFYRIVEPELKFVALLEFLSS 261
                :.||| ...||..:....:..|..|.:|.:.:|  |..:.:...:|:|::.  ...:.|..
  Fly   401 LQMVVCSATLHAFEVKKMAERLMHFPTWVDLKGEDAV--PETVHHVVCLVDPQMD--TTWQSLRQ 461

  Fly   262 PATVIG---------------------------------------KVMVFFPT---CACVEYWAE 284
            |....|                                       :.::|..|   |       :
  Fly   462 PIGTDGVHDRDNVHPGNHSKETLSQAVKLLKGEYCVHAIDKHNMDRAIIFCRTKQDC-------D 519

  Fly   285 ALPPLLPKR-----TVLGIHGKMK-NKRANVVEKFRNTPQAVLLCTDVLARGLDVPEIEWVVQWD 343
            .|...|.:|     :.:.:||..| .:|...:|.|:......|:||||.|||||:..:.:::...
  Fly   520 NLERFLRQRGGKHYSCVCLHGDRKPQERKENLEMFKRQQVKFLICTDVAARGLDITGLPFMINVT 584

  Fly   344 PPSTASSFVHRVGRTARQGNEGNA--LVFLLPSEDAYVH 380
            .|...:::|||:||..|....|.|  ||..:| |..:.|
  Fly   585 LPDDKTNYVHRIGRVGRAERMGLAISLVATVP-EKVWYH 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9630NP_649777.1 DEADc 6..226 CDD:238167 48/158 (30%)
DEXDc 22..232 CDD:214692 50/164 (30%)
HELICc 239..370 CDD:238034 37/180 (21%)
DUF4217 411..470 CDD:290667
Ddx1NP_524212.2 P-loop_NTPase 4..>62 CDD:304359
SPRY_DDX1 91..242 CDD:293933
SrmB 279..>612 CDD:223587 88/351 (25%)
P-loop_NTPase <280..426 CDD:304359 47/154 (31%)
Helicase_C 492..602 CDD:278689 28/116 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.