DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9630 and eIF4A

DIOPT Version :9

Sequence 1:NP_649777.1 Gene:CG9630 / 40974 FlyBaseID:FBgn0037561 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster


Alignment Length:372 Identity:111/372 - (29%)
Similarity:201/372 - (54%) Gaps:33/372 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WSSLDKPPLSDAVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLVPMLEILQ 70
            :.:.|...|.:.:|:.:..:||::.:.:|..||...:..:||.|:|.:|:|||..|.:.:|:   
  Fly    29 YDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQ--- 90

  Fly    71 RRHKETPWGPKEIGALVISPTRELARQISEV---LAQFLEHEDLEHLNQQLIVGGNSIEEDIATL 132
                :.....:|..||:::||||||.||..|   |.::::      ::....:||.::.||...|
  Fly    91 ----QIDTSIRECQALILAPTRELATQIQRVVMALGEYMK------VHSHACIGGTNVREDARIL 145

  Fly   133 RRETPC-ILVCTPGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNILGYLPR 196
              |:.| ::|.||||:.|:..||      ..:.:.::..||||||.:|..|||..:.::...||.
  Fly   146 --ESGCHVVVGTPGRVYDMINRK------VLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPP 202

  Fly   197 QRRTGLFSATQTTEVTDLIRAGLRNPVLVSVKEKASVNTPARLQNFYRIVEPE-LKFVALLEFLS 260
            ..:..|.|||...:|.::.|..:|:||.:.||::..  |...::.||..|:.| .|...|.:...
  Fly   203 DVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEEL--TLEGIKQFYVNVKQENWKLGTLCDLYD 265

  Fly   261 SPATVIGKVMVFFPTCACVEYWAEALPPLLPKRTVLGIHGKMKNK-RANVVEKFRNTPQAVLLCT 324
            :.:  |.:.::|..|...|:...:.:.  :...||..:||.|:.: |..::::||:....||:.|
  Fly   266 TLS--ITQSVIFCNTRRKVDQLTQEMS--IHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITT 326

  Fly   325 DVLARGLDVPEIEWVVQWDPPSTASSFVHRVGRTARQGNEGNALVFL 371
            |:||||:||.::..|:.:|.||...:::||:||..|.|.:|.|:.|:
  Fly   327 DLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9630NP_649777.1 DEADc 6..226 CDD:238167 67/223 (30%)
DEXDc 22..232 CDD:214692 66/213 (31%)
HELICc 239..370 CDD:238034 40/132 (30%)
DUF4217 411..470 CDD:290667
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 111/372 (30%)
DEADc 32..232 CDD:238167 67/220 (30%)
Helicase_C 254..358 CDD:278689 30/107 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.