DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpA-70 and AT1G36920

DIOPT Version :9

Sequence 1:NP_524274.1 Gene:RpA-70 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001319155.1 Gene:AT1G36920 / 840600 AraportID:AT1G36920 Length:177 Species:Arabidopsis thaliana


Alignment Length:156 Identity:30/156 - (19%)
Similarity:60/156 - (38%) Gaps:35/156 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LQILAIK--KINSAADSERYRILISDGKYFNSYAMLASQLNVMQHNGELEEFTIVQLDKYVTSLV 87
            |:||.|.  .:....:.::...||.:..:...:.:|.|.:..:.:.|:    ..||..|:.|.  
plant    20 LKILGIHLLMLPYGVNLQKMSTLILNLNHQVPFFLLGSLMKTLLYQGK----GTVQSSKFTTK-- 78

  Fly    88 GKDGAGKRVLIISELTVVNPGAEVKSKIGEPVTYENAAKQDLAPKPAVT----SNSKPIAKKEPS 148
                                 |.:.|.:.|.:.::.|...: .|:.|:|    |.|..|:|:...
plant    79 ---------------------AYIHSPLPEILRFQEALCNE-EPRLAITEIKSSKSAHISKQSFH 121

  Fly   149 HNNNNNIVMNSSINSGMT-HPISSLS 173
            .:....|:.....|..|| :.::|:|
plant   122 LSERKTIIELMETNQVMTCNILASIS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpA-70NP_524274.1 rpa1 3..595 CDD:273177 30/156 (19%)
Rep-A_N 6..107 CDD:281980 13/83 (16%)
RPA1_DBD_A 168..270 CDD:239920 2/6 (33%)
RPA1_DBD_B 301..401 CDD:239921
Rep_fac-A_C 444..589 CDD:285809
AT1G36920NP_001319155.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1189265at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.