DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpA-70 and AT1G36510

DIOPT Version :9

Sequence 1:NP_524274.1 Gene:RpA-70 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_174868.1 Gene:AT1G36510 / 840559 AraportID:AT1G36510 Length:351 Species:Arabidopsis thaliana


Alignment Length:200 Identity:41/200 - (20%)
Similarity:66/200 - (33%) Gaps:82/200 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 NIVMNSSINSGMTHPISSLSPYQNKWVIKARVTSKSGIRTWSNARGEGKLF---SMDLMDESGEI 215
            :|:.||.:.      :..::|..:::.||.||     :|.|       :||   .|.|:|..| .
plant     3 SILSNSFVY------LREINPALDQYKIKVRV-----VRLW-------RLFKSIEMVLVDGEG-T 48

  Fly   216 RATAFKEQCDKFYDLIQVDSVYYISKCQLKPANKQYSSLNNAYEMTF-SGETVVQLCEDTDDDPI 279
            |..|..|:                             .|...::..| |||:.:       .|..
plant    49 RVHASIEE-----------------------------GLGKRFQHQFVSGESRI-------IDTF 77

  Fly   280 PEIKYNLVPISDVSGMENKAAVDTIGICKEVGELQSFVAR---TTNKEFKKRDITLVDMSN---- 337
            ..:.|:                |.:|...:||.|.|..|:   |........|:..||..|    
plant    78 SFVYYD----------------DVLGQIVDVGSLDSIKAKGKDTVKLSAGSEDLIHVDSENKTSH 126

  Fly   338 SAISL 342
            ||::|
plant   127 SAVTL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpA-70NP_524274.1 rpa1 3..595 CDD:273177 40/199 (20%)
Rep-A_N 6..107 CDD:281980
RPA1_DBD_A 168..270 CDD:239920 21/105 (20%)
RPA1_DBD_B 301..401 CDD:239921 14/48 (29%)
Rep_fac-A_C 444..589 CDD:285809
AT1G36510NP_174868.1 RPA1_DBD_A_like 23..>83 CDD:239926 21/108 (19%)
RPA_2b-aaRSs_OBF_like 153..267 CDD:299125
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1189265at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.