DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpA-70 and AT1G14800

DIOPT Version :9

Sequence 1:NP_524274.1 Gene:RpA-70 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_172933.1 Gene:AT1G14800 / 838045 AraportID:AT1G14800 Length:384 Species:Arabidopsis thaliana


Alignment Length:215 Identity:39/215 - (18%)
Similarity:68/215 - (31%) Gaps:73/215 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 IRTWS--NARGEGKLFSMDLM---DESGEIRATAFKEQCDKFYDLIQVDSVYYISKCQLKPANKQ 250
            :|.|.  |.:.:|:...:.|:   ::...|.|.........|..:::...::.:|..::....|.
plant    35 LRFWDARNIKKDGQFMGIVLLLLDEKCSVIHAFIPAALASHFRQVLREGIIFNVSGFEVGRCTKL 99

  Fly   251 YSSLNNAYEMTFSGETVVQLCEDTDDDPIPEIKYNLVPISDVSGMENKAAVDTIGICKEVGELQS 315
            |...::.:.:.|...|.:                  :.:|||.        .||       |.:.
plant   100 YKITDHPFLLRFLPATTI------------------IEVSDVG--------PTI-------EREK 131

  Fly   316 FVAR---------TTNKEFKKRDITLVDMSN-------------------SAISLTLWGDDAVNF 352
            |:.|         .||.|...: ||.|..||                   ..:.|:||.|.|..|
plant   132 FMLRNFDNLQALANTNIELPGQ-ITFVQGSNLNDPTSTQRLVLRYRIDSSVIVYLSLWDDVAATF 195

  Fly   353 DGHVQPVILVKGTRINEFNG 372
            ..|      :...|..|..|
plant   196 RAH------LSSGRAEELEG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpA-70NP_524274.1 rpa1 3..595 CDD:273177 39/215 (18%)
Rep-A_N 6..107 CDD:281980
RPA1_DBD_A 168..270 CDD:239920 13/83 (16%)
RPA1_DBD_B 301..401 CDD:239921 23/100 (23%)
Rep_fac-A_C 444..589 CDD:285809
AT1G14800NP_172933.1 RPA1_DBD_A_like 30..117 CDD:239926 13/81 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1189265at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.