powered by:
Protein Alignment RpA-70 and AT5G28885
DIOPT Version :9
Sequence 1: | NP_524274.1 |
Gene: | RpA-70 / 40972 |
FlyBaseID: | FBgn0010173 |
Length: | 603 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_680253.1 |
Gene: | AT5G28885 / 833008 |
AraportID: | AT5G28885 |
Length: | 184 |
Species: | Arabidopsis thaliana |
Alignment Length: | 73 |
Identity: | 18/73 - (24%) |
Similarity: | 33/73 - (45%) |
Gaps: | 4/73 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 283 KYNLVPISDVSGMEN--KAAVDTIGICKEVGELQSFVARTTNKEFKKRDITLVDMSNSAISLTLW 345
::|..|.|.:....: :|.:|..| :.:|..:..|...::...|..||.|.|:|.:....||.
plant 75 RFNFSPFSKILTQSDVGEAFIDVSG--EIIGMSEIIVKDCSDNMSKLLDIQLRDLSQTIPECTLR 137
Fly 346 GDDAVNFD 353
..|:.:.|
plant 138 MPDSESND 145
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1189265at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.