DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpA-70 and AT3G30730

DIOPT Version :9

Sequence 1:NP_524274.1 Gene:RpA-70 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001327684.1 Gene:AT3G30730 / 822811 AraportID:AT3G30730 Length:161 Species:Arabidopsis thaliana


Alignment Length:197 Identity:36/197 - (18%)
Similarity:62/197 - (31%) Gaps:68/197 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 KKEPSHNNNNNIVMNSSINSGMTHPISSLSPY--QNKWVIKARVTSKSG----IRTWS--NARGE 200
            ||:.||.|.|.....:.         .||.||  ||...|......|..    |..|.  |.:..
plant    22 KKQTSHYNPNMAPHKAQ---------QSLQPYTFQNFDDIDGDFCQKEVLLRLIYIWEARNIKKG 77

  Fly   201 GKLFSMDLM---DESGEIRATAFKEQCDKFYDLIQVDSVYYISKCQLKPANKQYSSLNNAYEMTF 262
            ..|...:|:   .:|..:.......:...:.:.::.:|:|.::|.       ::.:.:||.:..|
plant    78 NILMGFELLFIYSQSNPMEGFISANRIFPYQEDLKYNSIYKLNKV-------EWCNSSNAIKYLF 135

  Fly   263 SGETVVQLCEDTDDDPIPEIKYNLVPISDVSGMENKAAVDTIGICKEVGELQSFVARTTNKEFKK 327
                                ||       |:...||:|:              |:.:.||.....
plant   136 --------------------KY-------VTKGVNKSAI--------------FIEKGTNTTSNS 159

  Fly   328 RD 329
            .|
plant   160 ED 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpA-70NP_524274.1 rpa1 3..595 CDD:273177 36/197 (18%)
Rep-A_N 6..107 CDD:281980
RPA1_DBD_A 168..270 CDD:239920 20/112 (18%)
RPA1_DBD_B 301..401 CDD:239921 4/29 (14%)
Rep_fac-A_C 444..589 CDD:285809
AT3G30730NP_001327684.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1189265at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.