DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA1 and AT1G74875

DIOPT Version :10

Sequence 1:NP_524274.1 Gene:RPA1 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001154471.1 Gene:AT1G74875 / 7922311 AraportID:AT1G74875 Length:243 Species:Arabidopsis thaliana


Alignment Length:73 Identity:15/73 - (20%)
Similarity:28/73 - (38%) Gaps:16/73 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SSLSPYQN--------------KWVIKARVTSKSGIRTWSNARGEGKLFSMDLMDESGEIRATAF 220
            ||||.::|              :::::....:|..:..|.|.:.....|..  ..:||.:.|...
plant    30 SSLSEFRNLQLVSKSFKRISNDRYILQRLSLNKIPLLPWRNRKKFHNFFKR--CRKSGNLEAIYR 92

  Fly   221 KEQCDKFY 228
            |...|.|:
plant    93 KGLVDYFH 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA1NP_524274.1 rpa1 3..595 CDD:273177 15/73 (21%)
AT1G74875NP_001154471.1 None

Return to query results.
Submit another query.