DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpA-70 and Meiob

DIOPT Version :9

Sequence 1:NP_524274.1 Gene:RpA-70 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001108505.1 Gene:Meiob / 685099 RGDID:1583204 Length:470 Species:Rattus norvegicus


Alignment Length:407 Identity:81/407 - (19%)
Similarity:160/407 - (39%) Gaps:57/407 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 ISSLSPYQNKWVIKARVTSKSGIRTW---SNARGEGKLFSMDLMDESGE-IRATAFKEQCDKFYD 229
            :|.|.|......|...|..|:.::.:   .|...|...||..:.|.... :..:::..:     |
  Rat    13 LSDLHPNMANLKIIGIVIGKTDVKGFPDRKNIGSERYTFSFTIRDSPNHFVNVSSWGSE-----D 72

  Fly   230 LIQ-VDSVYYISKC--------QLKPANKQ--YS-SLNNAYEMTFS-GETVVQLCEDTDDD---- 277
            .|: :...:.:.:|        |.|...::  :| :..:.|::..| ..::|::|...:.|    
  Rat    73 YIRSLSDNFKVGECVIIENPLIQRKETEREERFSPATPSNYKLLLSENHSMVKVCSPYEVDTKLL 137

  Fly   278 -----PIPEIK--YNLVPISDVSGMENKAAVDTIGICKEVGELQSFVARTTNKEFKKRDITLVDM 335
                 |:.|.:  |:|..|.......:...::.:...:.|||.:.|.. :..::.::.::.|.|.
  Rat   138 SLIHLPVKESRDYYSLADIVANGHSLDGRIINVLAAVRSVGEPKYFTT-SDRRKGQRCEVKLFDE 201

  Fly   336 SNSAISLTLWGDDAVNFDGH---VQPVILVKGTRI--NEFNGGKSLSLGGGSIMKINPDIPEAHK 395
            :..:.::|.|.::::.....   .:.||.....||  |:|....:.::...:|:.:|||.|||:.
  Rat   202 TEPSFTMTCWDNESILLAQSWMARETVIFASDVRINFNKFQNCMAATVISKTIITVNPDTPEANI 266

  Fly   396 LRGWFDNGGGDSVAN--------MVSARTGGGSFSTEWMTLKDARARNLGSGDKPDYFQCKAVVH 452
            |..:.......|:|:        .|:..|....::.|  .||.....|.|..| |.|....|.:.
  Rat   267 LLNFIRENKETSIADEIDSYLKESVNLNTIVNVYTVE--QLKGKALENEGKVD-PFYGILYAYIS 328

  Fly   453 IVKQENAFYRA----CPQSDCNKKVVDEGNDQFRCEKCNALFPNFKYRLLINMSIGDWTSN-RWV 512
            .:..::...:.    |  |.|...|.|..|....|.|.::...:|.....:.:.:.|.|.. |..
  Rat   329 TLNIDDETTKVVRNRC--SSCGYIVNDASNTCTICSKDSSRSRSFCLSFDVLVDLTDHTGTLRSC 391

  Fly   513 SSFNEVGEQLLGHTSQE 529
            |....|.|:.||.|..|
  Rat   392 SLSGSVAEETLGCTINE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpA-70NP_524274.1 rpa1 3..595 CDD:273177 81/407 (20%)
Rep-A_N 6..107 CDD:281980
RPA1_DBD_A 168..270 CDD:239920 20/117 (17%)
RPA1_DBD_B 301..401 CDD:239921 22/104 (21%)
Rep_fac-A_C 444..589 CDD:285809 21/91 (23%)
MeiobNP_001108505.1 rpa1 <165..408 CDD:273177 53/248 (21%)
RPA1_DBD_B 167..270 CDD:239921 22/103 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.